IgG fraction of antiserum
NA.41
primary antibodies
rabbit, rat, human, bovine, horse, mouse, dog, guinea pig
rabbit
polyclonal
unconjugated
immunohistochemistry: suitable;western blot: suitable
human ... TBX15(6913)
Q5JT54
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Rabbit anti-TBX15 antibody is suitable for western blot applications at a concentration of 1.25μg/ml and for IHC applications (using paraffin-embedded tissues) at 4-8μg/ml.
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
TBX15 codes for T-box transcription factor that regulates embryonic development. TBX15 mutations have been linked to Cousin syndrome. Rabbit anti-TBX15 antibody recognizes human, mouse, rat, and canine TBX15.
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Synthetic peptide directed towards the C terminal region of human TBX15
TBX15 is a probable transcriptional regulator involved in developmental processes.
Synthetic peptide located within the following region: YGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMH